PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim02g063520.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HD-ZIP
Protein Properties Length: 253aa    MW: 28078.6 Da    PI: 8.3397
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim02g063520.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.11.3e-17113167256
                         T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         +k+ ++tk q   Lee F+++++++ ++++ LA+kl++  rqV vWFqNrRa+ k
  Sopim02g063520.0.1 113 KKKLRLTKVQSALLEESFKQQSTLNLKQKQNLARKLNVRPRQVEVWFQNRRARTK 167
                         677899***********************************************98 PP

2HD-ZIP_I/II110.51.2e-35113201190
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                         +kk+rl+k q++lLEesF+++++L+ ++K++lar+L+++prqv+vWFqnrRARtk+kq+E+d+e+Lk+ +++l++en++L ke +eL+ +
  Sopim02g063520.0.1 113 KKKLRLTKVQSALLEESFKQQSTLNLKQKQNLARKLNVRPRQVEVWFQNRRARTKLKQTEVDCEFLKKYCETLTDENKKLYKELQELK-A 201
                         59*************************************************************************************9.4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.67E-1799170IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.5E-17102170IPR009057Homeodomain-like
PROSITE profilePS5007116.39109169IPR001356Homeobox domain
SMARTSM003896.3E-13111173IPR001356Homeobox domain
PfamPF000464.6E-15113167IPR001356Homeobox domain
CDDcd000867.47E-15113170No hitNo description
PROSITE patternPS000270144167IPR017970Homeobox, conserved site
PfamPF021837.1E-8169203IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.4E-21169212IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MESIYDSAGL DLGLGYSSTV NQTSRKDGQV AAVKSDLGFE PSLNLSLSSG DHQMVDLKTE  60
NKDQLSVASS YSNGSVKRER DIGSEVTEVE RVISCRVSHD EDYYEDDDAS NGKKKLRLTK  120
VQSALLEESF KQQSTLNLKQ KQNLARKLNV RPRQVEVWFQ NRRARTKLKQ TEVDCEFLKK  180
YCETLTDENK KLYKELQELK ALKVGQPLYM KLPAAATLTV CPSCERVGAG AAQNSAKPPH  240
LYGSFTNPSA AC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1161169RRARTKLKQ
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755140.0HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010317182.10.0PREDICTED: homeobox-leucine zipper protein HAT22
SwissprotP466046e-75HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLK4B6N70.0K4B6N7_SOLLC; Uncharacterized protein
STRINGSolyc02g063520.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29024186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.14e-76HD-ZIP family protein